PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.2G060600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 417aa    MW: 45237.3 Da    PI: 4.6441
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.2G060600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.22e-14210267461
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                          k+ +rk++NRe+ArrsR RK a ++e e+ v++L+ eN++L  +l +l++++   + 
  Sevir.2G060600.1.p 210 EKVRKRKESNRESARRSRYRKAAHLKEMEDQVAQLKVENSSLLRRLATLNQKYTDATV 267
                         5899**********************************************99876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.2E-20207271IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.634209261IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-11209262No hitNo description
PfamPF001703.8E-11210262IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.0E-10211262No hitNo description
CDDcd147023.95E-20213262No hitNo description
PROSITE patternPS000360214229IPR004827Basic-leucine zipper domain
PfamPF124981.6E-13278388IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 417 aa     Download sequence    Send to blast
MDDHAVSMEE IIPDPFWEDL PPPPEPHLVT SDGLIDGVVT DGGGEGTNAM DQNQSPSEWS  60
FERLLEEELL TDAAPLENFS GSAPHADTVV EEVDHATMAP AAVSTVGDPM EYNTILKRKL  120
DEDLATVAMW RASSVVHPEH SQGSNNYIGG NINFVQNMRS ISEGPINRAR NAYIRARLAT  180
SSSSRDPSPS DDDDMDGEVE ILGFKLPTEE KVRKRKESNR ESARRSRYRK AAHLKEMEDQ  240
VAQLKVENSS LLRRLATLNQ KYTDATVDNR VLKANMETLR AKVKMAEDAL KRVTGTMSSS  300
QPSRPSPPVP ANADASGPIL DNIIDYLMNS TDATTDNNFE PRTATTPSFS QQAEKPAAAS  360
TNSAMINRIA AHHAVAVELL HKRLGAMPTA SSGVAPPPEP APPSDVLVES TDMGVH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5139851e-139AF513985.1 Pennisetum glaucum opaque-2-like protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004955660.10.0PREDICTED: regulatory protein opaque-2-like
SwissprotP129591e-100OP2_MAIZE; Regulatory protein opaque-2
TrEMBLK3ZTP00.0K3ZTP0_SETIT; Uncharacterized protein
STRINGSi029970m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34883878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.22e-25bZIP family protein